SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7I8Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7I8Y4
Domain Number 1 Region: 405-598
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-49
Family cAMP-binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 158-403
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.54e-39
Family Voltage-gated potassium channels 0.0057
Further Details:      
 
Weak hits

Sequence:  F7I8Y4
Domain Number - Region: 617-663
Classification Level Classification E-value
Superfamily Tropomyosin 0.0915
Family Tropomyosin 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7I8Y4
Sequence length 689
Comment (tr|F7I8Y4|F7I8Y4_CALJA) Cyclic nucleotide gated channel alpha 1 {ECO:0000313|Ensembl:ENSCJAP00000035074} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=CNGA1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MKLTMKKNIINTQLSFVNMPNVIVPDIEKEIRRMENGACSSFSDDDDSASICEESENENP
HTRGSSSYKLHRKGGPSQREQYLPGAIALFNVNNSSNKDQKPNEWKFPTVENDIKKGTEV
INVNDVKKRTKSGDKNENTKDPSKDKKEEEKKEVVIIDPSGNTYYNWLFCITLPVMYNWT
MVIARACFDELQSDYLEYWIVLDYVSDIVYLMDMFVRTRTGYLEQGLLVREELKLINKYK
SNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRISRMFEFFQRTETRTNYPNIFRIS
NLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTLT
TIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQYM
HFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIFA
DCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSDG
SYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGRQ
ILMKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLTK
VEKFLKPLIDTEFSSIEGPGADSAPIDST
Download sequence
Identical sequences F7I8Y4
ENSCJAP00000035074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]