SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7IBK7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IBK7
Domain Number 1 Region: 139-241
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 6.02e-34
Family Elongation factor TFIIS domain 2 0.0046
Further Details:      
 
Domain Number 2 Region: 258-308
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.29e-17
Family Transcriptional factor domain 0.00021
Further Details:      
 
Domain Number 3 Region: 1-47
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0000000000000144
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IBK7
Sequence length 310
Comment (tr|F7IBK7|F7IBK7_CALJA) Transcription elongation factor A1 {ECO:0000313|Ensembl:ENSCJAP00000026567} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TCEA1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLVSPGKYRGRDHISQIWKE
RRLECKDWGLAMLPGLNGPSTEKDLDEKKKEPAITSQNSPEAREESHIYIASHNFTSSIN
SPIILCSPIYTPFFVFSSNVLAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQ
IEEAIYQEIRNTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASD
ELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVC
NECGNRWKIC
Download sequence
Identical sequences F7IBK7
ENSCJAP00000026567 ENSCJAP00000049213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]