SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7ID09 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7ID09
Domain Number 1 Region: 891-1027,1085-1151
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.13e-38
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000366
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000085
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7ID09
Sequence length 1151
Comment (tr|F7ID09|F7ID09_CALJA) Proteoglycan 4 {ECO:0000313|Ensembl:ENSCJAP00000010768} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=PRG4 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MAWKTLPIYLLLLLSAFLIQQVSSQDLSSCAGRCGEGYSRDTTCSCDFNCQHYMDCCLDF
KRVCTVELSCKGRCFESFERGRECDCDAQCEKYGKCCPDYDRFCEAVHNPTSPPSSEKAP
PPPGASQSIKSTTKRSPKPPNKKKTKKVVESEEITEEHSVSENQETIRKIKSSKNSAANR
ELQKKPKVKDNKKNRAKKTHAPKPQVEDEAGSGLDNDDFKVTTTPDMPTTQHNKVTTSPK
TTTAKPINPRPSLPPNSDTSKETSLTANKETTVETNETTKTDKQTSTDAKEKTTAAKETK
SVEKTSAKDLAPTSKVPAIPTLKAETTTKGPALTISKEPAPTTPKQPVPTTTKEPAPTTP
KEPAPTTTKKPAPITTREPTPTTPKEPASTTPNEPVPTTTKKPAPTTPKEPAPTTPKEPA
PTTTKEAAPTTLKEPTPTTTKKPVPITPTEPAPTTPKKPVPITPKEPAPTTSKKPVPTTP
EELTPTTVDEPAFTTPEGPAPTTVDEPAFTTPEEPNPTTPEEPVPTTPEGPAPTTPEEPV
PTTPEEPAPTTPEEPAPTTPEEPAPTTPEEPIPTNTEEAAPTTPKEPAPKERASFFSPRG
FLFLTPRRGAPERNINNSPGGDTPTKYKRSLPPFVKPRRKGFFTHRLKGPGATPKKKALF
VFFHPEKMGKFVWKFWGGQGGTNSHRKKTPPSAPKYNKVATKQATNFKIPPFISNLATLR
ATTLHPKVKCSNNKRTETMNTPEETPNPKDTATNSKATTPKPQKPKGTQENLKAPKTPTS
TKKPKTPPRVRKPKTTPTPRKMTSTMPELNPTSTVAEAMIQTTTRPNQTPDSRPVEVNPK
NEGANGAEGETAHTILRPHVFTPIVIPGTDYLLQVPNQGIFINPKLSDETNICNGKPVDG
LTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFTRCNCEGKTFFFKD
SQYWRFTNDIKDAGYPKPIVKGFRGLTGQIVAALSIAKYKNRPESVYFFKRGGNIQKYIY
KQEPVQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSQTHTIRIHYSPVRLPYQDKDFL
HNEVKVSTLWRGLPNMVTSAIALPNIRKPDGFDYYAFSKDQYYNIDVPSRTARAITTRSG
QTLSKVWYNCP
Download sequence
Identical sequences F7ID09
ENSCJAP00000010768 ENSCJAP00000010768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]