SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7IET6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IET6
Domain Number 1 Region: 45-137
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000265
Family N-acetyl transferase, NAT 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F7IET6
Sequence length 219
Comment (tr|F7IET6|F7IET6_CALJA) Arginyltransferase 1 {ECO:0000313|Ensembl:ENSCJAP00000043617} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=ATE1 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MVIHKNSPDTPTESQFTRFLCTSPLEAETPPNGPDCGYGSFHQQYWLDGKIIAVGVIDIL
PNCVSSVYLYYDPDYSFLSLGVYSALREIAFTRQLHEKTSQLSYYYMGFYIHSCPKMRYK
GQYRPSDLLCPETYVWVPIEQCLPSLENSKYCRFNQDPEAVDEDRSTEPDRVQVFHKRAI
MPYGVYKKHQKDPSEEAAVLQYASLVGQKCSERMLLFRN
Download sequence
Identical sequences F7IET6
ENSCJAP00000043617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]