SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7IGV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IGV5
Domain Number 1 Region: 632-889
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-55
Family YWTD domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 21-280
Classification Level Classification E-value
Superfamily YWTD domain 3.14e-54
Family YWTD domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 331-577
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-49
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 937-1196
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-39
Family YWTD domain 0.0000396
Further Details:      
 
Domain Number 5 Region: 891-938
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000898
Family EGF-type module 0.015
Further Details:      
 
Domain Number 6 Region: 1327-1365
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 587-634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1249-1287
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1289-1325
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000798
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 10 Region: 283-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000341
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 11 Region: 1206-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000897
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F7IGV5
Sequence length 1615
Comment (tr|F7IGV5|F7IGV5_CALJA) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=LRP6 OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATHGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKQTEFNKTESVQRVVVSGILSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPTSGFMYWTDWGEVPKIERAGMDGSSRFIIVNSD
IYWPNGLTVDYEERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLHEIHSNIFSPMDIHVFSQQRQPNATNLCAIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAVDYDPVEGYIYWTDDEVRAIRRSFLDGSGSQFVVTAQIAHPDGVAVDWIARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKVYWGDAKTDKIEVVNTDGSGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLEIGLNREVIADDLPHPFGL
TQYQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNG
HCSHLCLAVPVGGFVCGCPAHYSLNADNKTCSAPTTFLLFSQKSAINRMVIDEQQSPDII
LPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYD
LSIDIYSRYIYWTCEAANVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQE
RSPKIERAALDGTEREVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIV
LEDSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELN
LQEYRQHPCAQDNGGCSHICLVKGDGTTRCSCPVHLVLLQDELSCGEPPTCSPQQFTCFT
GEIDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSD
EKTCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVI
GVIVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPGSLSGSLPG
MSRGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHY
TMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTS
DLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences F7IGV5
ENSCJAP00000040292 ENSCJAP00000040292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]