SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7IR89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7IR89
Domain Number 1 Region: 187-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 5.89e-41
Family NadC C-terminal domain-like 0.03
Further Details:      
 
Weak hits

Sequence:  F7IR89
Domain Number - Region: 10-73,113-152
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.00012
Family NadC N-terminal domain-like 0.016
Further Details:      
 
Domain Number - Region: 86-118
Classification Level Classification E-value
Superfamily DUSP-like 0.0785
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7IR89
Sequence length 491
Comment (tr|F7IR89|F7IR89_CALJA) Nicotinamide phosphoribosyltransferase {ECO:0000313|EMBL:JAB09819.1, ECO:0000313|Ensembl:ENSCJAP00000029857} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=NAMPT OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MNAAAEAEFNILLATDSYKVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFY
GLQYILNKYLKGKVITKEKIQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEVKAVP
EGSVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKVLEILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINT
LQEIVEGMKLKKWSIENVSFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNIELEAAPH
Download sequence
Identical sequences F7IR89
ENSCJAP00000029857 XP_002751770.1.60252 ENSCJAP00000029857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]