SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F7V7D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F7V7D2
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.04e-83
Family Protein kinases, catalytic subunit 0.00000133
Further Details:      
 
Domain Number 2 Region: 539-600
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000772
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0081
Further Details:      
 
Domain Number 3 Region: 472-533
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000667
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  F7V7D2
Domain Number - Region: 402-463
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00706
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F7V7D2
Sequence length 690
Comment (tr|F7V7D2|F7V7D2_CLOSS) Serine/threonine protein kinase {ECO:0000313|EMBL:BAK48560.1} KW=Complete proteome; Reference proteome OX=1042156 OS=Clostridium sp. (strain SY8519). GN=CXIVA_25910 OC=Clostridium.
Sequence
MLESGMYIANRYEIVGKVGVGGMADVYKAKDATLDRYVAIKVLKQEFCEDMNFVTKFRTE
AQSAASLEHPNIVNIYDVGSENGIYYIVMEYVEGITLKEYIQKKGKLSYKETLSIAIQVS
RGIQAAHEKGIIHRDIKPQNIIISTDGKVKVTDFGIARAASTNTIHSDVMGSVHYASPEQ
ARNGYVSDKSDIYSLGIVMYEMVTGKVPFDGDSTVQIAIQHLQDEMVSPRAYAQNLPVSL
EKIILKCTQKNPDRRYENIEELLIDLRRSLVSPNTDFVSFAPVADGATRVISEKELKEIQ
NQTEGVSPEHAAPVETREQYSPVRNENTFDPEEDAKASRKEKLITTFGIIGVVVIVIIFL
LILGNIFGWFRFGSKNNTAATTQTSAVSEQTGESDSKKDDTVTMIDLKGMTYSQAKSQLE
SMGLKINQKSTEASEEYDKNEIISQDVSEGDSVKKGTTINVVVSTGKQEEEIDVPNVVGS
DASDAETLLENAGFVVKKKFDYSSTVDSGDVISQTPKAGKTAYKNDTVTITISQGMEKIK
VPDVIGMSQSEAQSALKAKGLKYTVVKDYSDDYDKGDVIAQSEKASTYVDSDTTIKLTVS
KGPKTVKYTYTGELNVPDLNEDQEVKYASVSLYDGNGTVVKYWSKITDFPYTLTATNIEN
SSSGVRKATFYFTDGTSHTYSSNVSFRKSS
Download sequence
Identical sequences F7V7D2
WP_013978513.1.77098 gi|339443657|ref|YP_004709662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]