SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8ANV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8ANV2
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000205
Family GHMP Kinase, N-terminal domain 0.0024
Further Details:      
 
Weak hits

Sequence:  F8ANV2
Domain Number - Region: 270-319
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00623
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8ANV2
Sequence length 336
Comment (tr|F8ANV2|F8ANV2_METOI) Beta-ribofuranosylaminobenzene 5'-phosphate synthase {ECO:0000256|PIRNR:PIRNR004884} KW=Complete proteome OX=647113 OS=Methanothermococcus okinawensis (strain DSM 14208 / JCM 11175 / IH1). GN=Metok_1124 OC=Methanococcaceae; Methanothermococcus.
Sequence
MVNIMKSKIISPSRIHMGLIDLNGSIGRVDGGIGITLNNPNFIIEGKESSDIEIEFDKNI
TDKNITNNEIEKRIYDISKKVLEYIGEKGIYLKIKSVIPQHSGLGSGTQMALSTGKLISL
IYQKELDSKTLSTITGRGGTSGIGVNAFEKGGFIVDGGHSFGKGKDKEDFRPSSASKNVR
APPVLFRHDFNWDVVLTIPKGESIYGNKEVDIFKKYCPIPLNETQKICHLILMKMMPAII
ENDISSFGEVVNKLQYIGFKKVELGLQKDIVKELLETLQKVSYSGLSSFGPTIYSICDGK
DSVKNVVETSKEFFDKYRIDGDIIITKGNNRGFDVK
Download sequence
Identical sequences F8ANV2
gi|336122096|ref|YP_004576871.1| WP_013867277.1.9613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]