SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8AYN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8AYN6
Domain Number 1 Region: 8-180
Classification Level Classification E-value
Superfamily Prim-pol domain 3.33e-19
Family Bifunctional DNA primase/polymerase N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8AYN6
Sequence length 292
Comment (tr|F8AYN6|F8AYN6_FRADG) Bifunctional DNA primase/polymerase {ECO:0000313|EMBL:AEH11611.1} KW=Complete proteome; Reference proteome OX=656024 OS=Frankia symbiont subsp. Datisca glomerata. GN=FsymDg_4358 OC=Bacteria; Actinobacteria; Frankiales; Frankiaceae; Frankia.
Sequence
MSHPPDPRQAAAVAYAAAGRAVFVLGRSKRPVANCPACATAAPDHDRDGCACLTCHGFYA
ATTDPARIHAMLTTIPAGLLAVRTGAVSGLVVVDIDPGHGGRLDRTLMTPTATVATGGGG
WHLYYQHPGTPVLSRPLPGHVGIDIKADGGYVTAPPSTHPTTGRPYQWVGTRPVNEMPPA
LLTLCQTPPAPPHPFPAAPAPRPTHGKGGGGISYPDRLLTAHLDAVARAPEGRRRTTLYG
AARGIARMITAGVISLEDARAALTAAGRAAEQTDRDIHAAITGGFRDEGLTP
Download sequence
Identical sequences F8AYN6
gi|336180157|ref|YP_004585532.1| WP_013875471.1.39566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]