SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8DBD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8DBD3
Domain Number 1 Region: 1-178
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 2.38e-39
Family H-NOX domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8DBD3
Sequence length 185
Comment (tr|F8DBD3|F8DBD3_HALXS) Heme NO binding domain protein {ECO:0000313|EMBL:AEH35914.1} KW=Complete proteome; Reference proteome OX=797210 OS=Halopiger xanaduensis (strain DSM 18323 / JCM 14033 / SH-6). GN=Halxa_1281 OC=Halopiger.
Sequence
MHGIVLKGLKDFVTEEYGADVWTDLHEAAGFRTRLYVPVTEYPDEIVLELVDAATDLTGL
EEPTLLAAFGRFLVPHLLSTYGVHVDREWTGLELIANVETYIHEALRAKQSGEFTPPELR
TRRVDDRRVALAYESDRGLCALARGLLEGIADYYDEPLHIEQRRCMHEGADCCVFVVTRR
RAGAV
Download sequence
Identical sequences F8DBD3
gi|336252686|ref|YP_004595793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]