SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8FGA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8FGA1
Domain Number 1 Region: 3-97
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8FGA1
Sequence length 104
Comment (tr|F8FGA1|F8FGA1_PAEMK) Anti-sigma-factor antagonist {ECO:0000313|EMBL:AEI43921.1} KW=Complete proteome OX=1036673 OS=Paenibacillus mucilaginosus (strain KNP414). GN=KNP414_05397 OC=Paenibacillus.
Sequence
MFQYHVTVKEETAHILFIGDIDIDGTEVMEDEVQPALSQHKAVVIDFSEVHFVDSSGIGL
LIKLVQTLQEGEVKVRIQHIRPEVNEVFELLQIGEILGPEVFES
Download sequence
Identical sequences F8FGA1 I0BNA9
gi|337749629|ref|YP_004643791.1| gi|386725295|ref|YP_006191621.1| WP_013919074.1.16585 WP_013919074.1.53882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]