SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8FWA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8FWA1
Domain Number 1 Region: 1-313
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 7.86e-94
Family Aldo-keto reductases (NADP) 0.0000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8FWA1
Sequence length 336
Comment (tr|F8FWA1|F8FWA1_PSEP6) Aldo/keto reductase {ECO:0000313|EMBL:AEJ13303.1} KW=Complete proteome OX=1042876 OS=Pseudomonas putida (strain S16). GN=PPS_2752 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MIYRPLGHSGLQVSALTLGSMMFGEQTSTEDALRIIDKAWDQGINFIDTADVYNAGRAEE
IVGEAVARHRHDWIVASKVGFGPADGLPNRSGLSRKHIFNALDATLTRMDMDYLDIYYLH
REDHKVPLEETVQAIGDLLRQGKIRYWGVSNFRGWRIAEACHIAERLGVPRPVVSQPLYN
IVNRQAEPEQLTAAAAHGLGVVPFSPLARGVLSGKYAPGAVPDAGSRAGRQDKRIMEVEW
RQESLAIARQIQAYVEAKGVGIVEFAIAWVLNNRLVSSAIVGPRTEEQWDTYGGALAVKI
TAEDEAFIDSLVTPGHASTPGFNDVAHFVSGRITVH
Download sequence
Identical sequences A0A059UY82 A0A099MZG7 F8FWA1 V9V303
WP_013972666.1.23948 WP_013972666.1.28354 WP_013972666.1.35335 WP_013972666.1.56258 WP_013972666.1.65739 WP_013972666.1.7288 WP_013972666.1.80759 gi|568187688|ref|YP_008960295.1| gi|339487655|ref|YP_004702183.1| gi|568182310|ref|YP_008954927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]