SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8G3G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8G3G6
Domain Number 1 Region: 3-199,401-653
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.33e-131
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000843
Further Details:      
 
Domain Number 2 Region: 658-934
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.51e-78
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00000928
Further Details:      
 
Domain Number 3 Region: 201-401
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 3.24e-53
Family ValRS/IleRS/LeuRS editing domain 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8G3G6
Sequence length 943
Comment (tr|F8G3G6|F8G3G6_PSEP6) Isoleucyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_02002} KW=Complete proteome OX=1042876 OS=Pseudomonas putida (strain S16). GN=PPS_0603 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTDYKATLNLPDTAFPMKAGLPQREPQILQRWDSIGLYQKLREIGKDRPKFVLHDGPPYA
NGKIHIGHALNKILKDMIVRSKTLAGFDAPYVPGWDCHGLPIEHKVEVTHGKHLSADRTR
ELCREYAAEQIEGQKTEFIRLGVLGDWDNPYKTMNFANEAGEIRALAEMVKQGFVFKGLK
PVNWCFDCGSALAEAEVEYADKKSQTIDVAFPVADDAKLAAAFGLASLAKPAAIVIWTTT
PWTIPANQALNIHPEFKYALVDTGERLLVLAEELVESCLKRYSLEGSVIATAQGSALELI
NFRHPFYDRLSPIYLADYVELGAGTGVVHSSPAYGEDDFVTCKRYGMVNDDILTPVQSNG
VYVDSLPFFGGQFIWKANPAIVEKLSEVGALMHTETISHSYMHCWRHKTPLIYRATAQWF
VGMDKQPTTGEPLRERALKAIEDTKFVPAWGQARLHSMIANRPDWCISRQRNWGVPIPFF
LHKQTGELHPRTVELMEAVAKRVEQEGIEAWFKLDAAELLGAEAEQYDKITDTLDVWFDS
GTTHWHVLRGSHDIGHATGPRADLYLEGSDQHRGWFHSSLLTGCAIDGHAPYRELLTHGF
TVDENGRKMSKSLGNTIEPEKVNNTLGADILRLWVAATDYSGEMAVSEQILQRSADAYRR
IRNTARFLLSNLSGFDPARDLLAPEDMLALDRWAVDRTLLLQRELEEHYSEYRFWNVYSK
VHNFCVQELGGFYLDIIKDRQYTTGANSVARRSCQTALYHISEALVRWIAPILAFTADEI
WQYLPGERNESVMLNGWYEGLSELPVGTELDRAYWDRVMAVKASVNKELENQRTAKVIGG
NLQAEVTLYADEGLSADLGKLGDELRFVLITSAASVVPFAQAPAEAVATEVEGLKLQVVK
SGHTKCGRCWHFRADVGSHPEHPEICGRCVDNLSGSGEVRHYA
Download sequence
Identical sequences A0A059USA0 A0A099MV40 F8G3G6 V7DG62 V9UWX3
WP_013970751.1.23948 WP_013970751.1.28354 WP_013970751.1.35335 WP_013970751.1.56258 WP_013970751.1.65739 WP_013970751.1.7288 WP_013970751.1.80759 gi|568185593|ref|YP_008958109.1| gi|568180159|ref|YP_008952676.1| gi|339485540|ref|YP_004700068.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]