SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8G4F1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8G4F1
Domain Number 1 Region: 1-348
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.66e-121
Family FMN-linked oxidoreductases 0.0000000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8G4F1
Sequence length 349
Comment (tr|F8G4F1|F8G4F1_PSEP6) NADH:flavin oxidoreductase/NADH oxidase {ECO:0000313|EMBL:AEJ14844.1} KW=Complete proteome OX=1042876 OS=Pseudomonas putida (strain S16). GN=PPS_4309 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTTLFDPITLGDLQLPNRIIMAPLTRCRADEGRVPNALMAEYYVQRASAGLILSEATSVS
AMGVGYPDTPGIWNDEQVRGWNNVTKAVHAAGGRIFLQLWHVGRISHPSYLNGELPVAPS
AIQPKGHVSLVRPLSDYPTPRALETEEIIDIVEAYRSGAENAKAAGFDGVEIHGANGYLL
DQFLQSSTNQRTDRYGGSLENRARLLLEVTDAAIEVWGANRVGVHLAPRADAHDMGDADR
AETFTYVARELGKRGIAFICSREKEADDSIGPLIKEAFGGPYIVNERFDKASANAALANG
KADAVAFGVPFIANPDLPARLAADAPLNEARPETFYGKGPVGYIDYPRL
Download sequence
Identical sequences A0A059V1H8 A0A099N693 A0A1L5PVP6 F8G4F1 V9V2L5 V9X2P7
gi|568183829|ref|YP_008956518.1| WP_013974072.1.23948 WP_013974072.1.28354 WP_013974072.1.32670 WP_013974072.1.35335 WP_013974072.1.41505 WP_013974072.1.52768 WP_013974072.1.56258 WP_013974072.1.59340 WP_013974072.1.61620 WP_013974072.1.65739 WP_013974072.1.7288 WP_013974072.1.76210 WP_013974072.1.76710 WP_013974072.1.80759 WP_013974072.1.92076 WP_013974072.1.9402 WP_013974072.1.99927 gi|568189202|ref|YP_008961881.1| gi|339489196|ref|YP_004703724.1| 2035969008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]