SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8GE48 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8GE48
Domain Number 1 Region: 17-200
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.49e-58
Family Methylesterase CheB, C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 293-487
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.17e-48
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00079
Further Details:      
 
Domain Number 3 Region: 230-296
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.000000000012
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.011
Further Details:      
 
Domain Number 4 Region: 731-851
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000488
Family BphP N-terminal domain-like 0.05
Further Details:      
 
Weak hits

Sequence:  F8GE48
Domain Number - Region: 669-749
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0628
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8GE48
Sequence length 865
Comment (tr|F8GE48|F8GE48_NITSI) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome; Reference proteome OX=261292 OS=Nitrosomonas sp. (strain Is79A3). GN=Nit79A3_3543 OC=Nitrosomonadaceae; Nitrosomonas.
Sequence
MVSLPDINQSANPPAKTRIVGIGASAGGLAALEQFMEQVPLESGLAYVVVQHLDPTQKAL
LAELLQRVTKLPVREAENRMRIEPDCVYVIPPNTELSVVDGVLNLEKPTEPRGLRLPINV
LFSSLARDQGERAIAVILSGMGSDGTLGLQAVRALGGLTVVQQPDSAQFDSMPRSAIAAE
CADIIAPPAELPARILAYTAQAPKLQEPGIAAEEVVQASSELPALPVNPLQSIFSLLRQQ
TRHDFSVYKPSTLHRRIERRMAIHGITTLALYAEYMQQNTQEIDLLFKELLIGVTSFFRD
PAVWQQLADFTLPELLARQTIEQKLRAWVVGCSTGEEAYSLAILFNEVVQRLSLRHDYTL
QIFATDLNPDAIATARRGLYPTAISADVSAERLARFFSAHDKYYRINKNIRDMVLFAQHD
VVLDPPFTKLNLLSCRNLMIYFDAALQRRLLPLFHYSLRPGGVLLLGSSETVGRFKQLFT
PIESRLRLYLRQDNASNTGPDLLVKSFPPLSKIKKELPVPHPTDTSQPAENLQTAADQVL
LQMYTPAAVVVNNAGDIVYISGRTGKYLEPAAGKVNWNFHAMVREGLRAPLADALKKAVT
ENEPVQLRGLQVQSAEGVQCVDVTVQAFRESSVLQGMMLIVFRDVVMPTPRRGRRKGKSA
VEASHEYELQQYQDEILKLREETHASNEELQSTNEELQSTNEELQSANEELTSSKEEMQS
MNEELQTINAELQNKLDALALAESDMKNLLNSTDIAILFLDQELNVRRYTEQASKIINVR
ESDIGRPLSDLTTILQYPALQDDVKETLRTLIFSEKQISAGDDRWFSVRIMPYRRLDNVI
DGAVITFVDISATKRLESKLCQDLD
Download sequence
Identical sequences F8GE48
WP_013967471.1.5279 gi|339484877|ref|YP_004696663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]