SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8JIT1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8JIT1
Domain Number 1 Region: 222-341
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000905
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8JIT1
Sequence length 349
Comment (tr|F8JIT1|F8JIT1_HYPSM) Cell division coordinator CpoB {ECO:0000256|HAMAP-Rule:MF_02066} KW=Complete proteome; Reference proteome OX=717785 OS=Hyphomicrobium sp. (strain MC1). GN=HYPMC_1017 OC=Hyphomicrobiaceae; Hyphomicrobium.
Sequence
MAKLAQIYSTGMGAFQAVALIAVMALSSGPLLSRPAMAQANDARGTKGGAAANASPDSAL
KARVDALEEQLVDMQVVVGTLETLAKNGGGGGGAASQPFPSAGSGADTARIESLETQVRA
LTAQVQQLTEQIQAQGGVQHRTDLPGGPDTASLGSGNGTPQAESAAIPGFGSTTVSPGNG
GNDAIGGLLNKQDQQGQANGWSSPPGAGVATAALPPASEASGDPKQAYETAYGYLLQRDY
GSAEASFNDFLKKYPNDSLAGNAQYWLGETYFVRGQYKAAAGAFLKGYQTYGQSGKAPDS
LLKLAMSLDRLGQKEAACSSFSELAAKFPTAPQSVKGRAQSERQRIGCQ
Download sequence
Identical sequences F8JIT1
WP_013946657.1.38999 WP_013946657.1.98067 gi|338737862|ref|YP_004674824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]