SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8JJ99 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8JJ99
Domain Number 1 Region: 9-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.43e-16
Family MarR-like transcriptional regulators 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8JJ99
Sequence length 139
Comment (tr|F8JJ99|F8JJ99_STREN) MarR family transcriptional regulator {ECO:0000313|EMBL:AEW98791.1} KW=Complete proteome; Reference proteome OX=1003195 OS=14057 / NRRL 8057). GN=SCATT_p05980 OC=Streptomyces.
Sequence
MDGVRLLGLGKRLTELGREVMDGAGPVTLTPGEIAVVADVLRHPGSSVREIGARTGFAQS
HVSNSVARLRERGLLETARDSADGRRTLVRPTARARRAVRARADRPADEVIAAAVPDAAT
ARRVTALLDELSGLLLPPR
Download sequence
Identical sequences F8JJ99
WP_014151583.1.28582 WP_014151583.1.70206 gi|357408501|ref|YP_004920424.1| gi|357408501|ref|YP_004920424.1|NC_016113 gi|386352497|ref|YP_006050744.1|NC_017585 gi|386352497|ref|YP_006050744.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]