SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8JSC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8JSC5
Domain Number 1 Region: 18-140
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.63e-29
Family MarR-like transcriptional regulators 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8JSC5
Sequence length 148
Comment (tr|F8JSC5|F8JSC5_STREN) Transcriptional regulator, MarR family {ECO:0000313|EMBL:AEW95440.1} KW=Complete proteome; Reference proteome OX=1003195 OS=14057 / NRRL 8057). GN=SCATT_30690 OC=Streptomyces.
Sequence
MPPTREESVETIQRELTAFARRARATAARMHPELSLVSFTLLTHLADQRGCRATDLAAHY
MLDKSTVSRQVAALEKLGFVERRPDPDDQRVQVLHPTPAGYETLAAVHASRLAIFHERLA
DWSEEDLARFAGYLERYSRTSAAEPPAS
Download sequence
Identical sequences F8JSC5
gi|357400662|ref|YP_004912587.1| WP_014143813.1.28582 WP_014143813.1.70206 gi|386356716|ref|YP_006054962.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]