SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8LC29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8LC29
Domain Number 1 Region: 2-242
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.52e-100
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000523
Further Details:      
 
Domain Number 2 Region: 243-456
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 4.05e-60
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000989
Further Details:      
 
Domain Number 3 Region: 549-703
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-45
Family AlaX-like 0.014
Further Details:      
 
Domain Number 4 Region: 452-548
Classification Level Classification E-value
Superfamily Translation proteins 6e-17
Family AlaX-M N-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8LC29
Sequence length 870
Comment (tr|F8LC29|F8LC29_9BACT) Alanyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00036} OX=765953 OS=Waddlia chondrophila 2032/99. GN=WCH_CL15170 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MNTQEIRRKFINYFRENGHTHVPSSPILPHDDPTLLFINAGMNQFKDIFLGKSVRDYKRA
VTSQKCIRVGGKHNDLENVGHTLRHLTFFEMLGNFSFGDYFKKEAIRFAWEVSTTVFELD
PERIWPTVFREDDEAYEIWKEYVPEEKITRFDEKQNFWSMGDTGPCGPCSELLYDRGPKY
GNAKTPLEDEKEERYMEFWNLVFMQYNRDEEGVMHPLPKPSIDTGSGLERVVSIKMDVES
VYDTDVLRALITRVEEISGIGYDGADKEKAPAFRVIADHIRCLAFAIADGVQPSNVDRGY
VLRKVLRRAVRYGRMLGLDRPFLADLVPLLIELMGSDYPELKQSENRIGEILTTEEENFI
RTLRRGGNILNQIIDEAKKEHRQITGEEAFKLKDTYGFPLEEILLIALDDELEVDTKRFI
ELEEEAKERSRKTRKSTQQLASENLFEGFASCEFLGYEETEAEGKVAAIIVDNAFVDQLE
AGQEGMIVLDRTPFYAEKGGQVGDKGLLTGENSLFHVSDCQSPYKGIIAHLGKLERGAIR
LKDPLMARVDLERRQSIANHHTATHLLHWALCKVLGDHVKQAGSVVAPDRLRFDFSHHKG
LTQKEIRDIEDLVNAKIRENIAVKSYELSYEEAIQREEIKQFFGDKYDNIVRVIDIDYSK
ELCGGTHVKQLGSIGLFRIAKEGSIAAGVRRIEAVTGSWAEQRSREEENLLLSIADSLKT
QPQKLIQRINSLLEENKELAQELKTLKSAHLKNIVADLINKAEEVQGIRFIAQEVALSSD
EMRQLADDAVNALESGVVVLAASLDGRCQLMARVSDDMIDKGIKASDLIKTLAPIIGGGG
GGKAHFAQAGGKTPEKISQALSTVRTLLSS
Download sequence
Identical sequences D6YTZ8 F8LC29
gi|297620478|ref|YP_003708615.1| WP_013181337.1.19835 WP_013181337.1.67671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]