SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8LD83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8LD83
Domain Number 1 Region: 93-340
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.49e-73
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000123
Further Details:      
 
Domain Number 2 Region: 14-99
Classification Level Classification E-value
Superfamily tRNA-binding arm 5.75e-18
Family Phenylalanyl-tRNA synthetase (PheRS) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8LD83
Sequence length 342
Comment (tr|F8LD83|F8LD83_9BACT) Phenylalanyl-tRNA synthetase alpha subunit {ECO:0000256|HAMAP-Rule:MF_00281} OX=765953 OS=Waddlia chondrophila 2032/99. GN=WCH_AD01010 OC=Bacteria; Chlamydiae; Parachlamydiales; Waddliaceae; Waddlia.
Sequence
MQAEIETLKKTFTAEIDQACSTASLEELKIKYLGRKGPVQDLMKSLKNASKEERPALGKL
INDLKEEISNGINGKYDDLLIVEEDRKIKEETIDITLPGKRRFSGRKHVITQSIDTILEI
LIGMGFSVQYGPDIDTDYYNYEALNFPEDHPARDMQDTFYITDNVLLRSHTSNVQTRVME
SAEPPIRIIAPGKTYRNETITARSHVFFHQIEALYIDKGVTFGDLLSTLDEFLSKLFDHD
VKTRYRPSYFPFVEPGLEVDVSCLSCSGKGCTLCKHTGWLEVAGAGMVHPEVLKNGNIDP
EIYTGYAWGLGVERLAMLKHGIKDIRLFTENHIRFLEQFPAI
Download sequence
Identical sequences D6YVW7 F8LD83
WP_013181992.1.19835 WP_013181992.1.67671 gi|297621147|ref|YP_003709284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]