SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F8VPA7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8VPA7
Domain Number 1 Region: 99-189
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.78e-18
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000058
Further Details:      
 
Domain Number 2 Region: 46-97
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000817
Family TS-N domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8VPA7
Sequence length 200
Comment (tr|F8VPA7|F8VPA7_HUMAN) Elongation factor Ts, mitochondrial {ECO:0000256|HAMAP-Rule:MF_03135} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TSFM OC=Catarrhini; Hominidae; Homo.
Sequence
MSLLRSLRVFLVARTGSYPAGSLLRQSPQPRHTFYAGPRLSASASSKELLMKLRRKTGYS
FVNCKKALETCGGDLKQAEIWLHKEAQKEGWSKAAKLQGRKTKEGLIGLLQEGNTTVLVE
VNCETDFVSRNLKFQLLVQQVALGTMMHCQTLKDQPSAYSKGFLNSSELSGLPAGPDREG
SLKDQLALAIVLRTHHICMI
Download sequence
Identical sequences F8VPA7
ENSP00000450041 ENSP00000450041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]