SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8W1R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8W1R0
Domain Number 1 Region: 104-317
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-59
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 300-462
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-34
Family Pleckstrin-homology domain (PH domain) 0.0019
Further Details:      
 
Domain Number 3 Region: 484-645
Classification Level Classification E-value
Superfamily PH domain-like 5.53e-23
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F8W1R0
Sequence length 673
Comment (tr|F8W1R0|F8W1R0_HUMAN) FYVE, RhoGEF and PH domain-containing protein 4 {ECO:0000313|Ensembl:ENSP00000446695} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FGD4 OC=Catarrhini; Hominidae; Homo.
Sequence
MAAQNQMECEEEKAATLSSDTSIQASEPLLDTHIVNGERDETATAPASPTTDSCDGNASD
SSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQKLHKIANE
LLLTERAYVNRLDLLDQVFYCKLLEEANRGSFPAEMVNKIFSNISSINAFHSKFLLPELE
KRMQEWETTPRIGDILQKLAPFLKMYGEYVKGFDNAMELVKNMTERIPQFKSVVEEIQKQ
KICGSLTLQHHMLEPVQRIPRYEMLLKDYLRKLPPDSLDWNDAKKSLEIISTAASHSNSA
IRKMENLKKLLEIYEMLGEEEDIVNPSNELIKEGQILKLAARNTSAQERYLFLFNNMLLY
CVPKFSLVGSKFTVRTRVGIDGMKIVETQNEEYPHTFQVSGKERTLELQASSAQDKEEWI
KALQETIDAFHQRHETFRNAIAKDNDIHSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFN
ALTRRRHHCRACGYVVCWKCSDYKAQLEYDGGKLSKVCKDCYQIISGFTDSEEKKRKGIL
EIESAEVSGNSVVCSFLQYMEKSKPWQKAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLG
YVVDEMPRSADLPHSFKLTQSKSVHSFAADSEELKQKWLKVILLAVTGETPGGPNEHPAT
LDDHPEPKKKSEC
Download sequence
Identical sequences F8W1R0
XP_005253364.1.92137 XP_005253365.1.92137 XP_005253366.1.92137 XP_016874293.1.92137 ENSP00000446695 ENSP00000446695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]