SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8WCI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8WCI6
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.06e-27
Family Transferrin 0.00000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8WCI6
Sequence length 120
Comment (tr|F8WCI6|F8WCI6_HUMAN) Serotransferrin {ECO:0000313|Ensembl:ENSP00000418396} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=TF OC=Catarrhini; Hominidae; Homo.
Sequence
MRLAVGALLVCAVLGLCLAVPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVK
KASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDFLLCCCCGEEG
Download sequence
Identical sequences F8WCI6
ENSP00000418396 ENSP00000418396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]