SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8WCL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F8WCL3
Domain Number 1 Region: 28-68
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000552
Family Cystathionine synthase-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F8WCL3
Sequence length 71
Comment (tr|F8WCL3|F8WCL3_HUMAN) Selenocysteine lyase {ECO:0000313|Ensembl:ENSP00000392517} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SCLY OC=Catarrhini; Hominidae; Homo.
Sequence
MEAAVAPGRDAPAPAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGN
PSSPYSAAYSM
Download sequence
Identical sequences F8WCL3
ENSP00000392517 ENSP00000392517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]