SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F8XWN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F8XWN2
Domain Number - Region: 23-80
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000353
Family Anti-sigma factor antagonist SpoIIaa 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F8XWN2
Sequence length 378
Comment (tr|F8XWN2|F8XWN2_9PROT) ABC transporter, permease protein, putative {ECO:0000313|EMBL:EGQ64125.1} KW=Complete proteome; Reference proteome OX=872330 OS=Acidithiobacillus sp. GGI-221. GN=GGI1_23636 OC=Acidithiobacillaceae; Acidithiobacillus.
Sequence
MTEKSPDPHTAKNSAHQPRWECDDGTLRLSGRWTLRRLGGRFAAQEAALRNISPEVCWDL
SAVEVLDSAGALLLWRAWGNHLPNNIRMADQHHSIFARLADIQPVAARPRHPWHFLDQLG
AFLIETGRDLWGLFLLMGALLLEFGRGLRHPRSFPWREISATIVNTGPNSLPILTLIGFL
IGVVISFQSASTLAQYGANIYIINIAGLSILREFGPLITAIILSGRSGSAFTAQIGGMCV
TEELDALRTFGIPPIRRLILPKVIGLALVMPLLVLWTDMVGLYGAMLVAKLELGISNRFF
IQQMPVVVPSFNLWLGVVKGALFGILIAWIAGFHGLKVKPNTTSLSRETTNSVVMSITVM
ILIDAILALVFANTGISN
Download sequence
Identical sequences B5ENL4 B7J5U5 F8XWN2
gi|198282934|ref|YP_002219255.1| gi|218665617|ref|YP_002425137.1| WP_009569367.1.13253 WP_009569367.1.28209 WP_009569367.1.49158 WP_009569367.1.50737 WP_009569367.1.90948 243159.AFE_0648 380394.Lferr_0798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]