SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F9FXE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F9FXE6
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 9.68e-85
Family Capz alpha-1 subunit 0.00000796
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F9FXE6
Sequence length 273
Comment (tr|F9FXE6|F9FXE6_FUSOF) Uncharacterized protein {ECO:0000313|EMBL:EGU78400.1} KW=Complete proteome; Reference proteome OX=660025 OS=Fusarium oxysporum (strain Fo5176) (Fusarium vascular wilt). GN=FOXB_11078 OC=Fusarium; Fusarium oxysporum species complex.
Sequence
MSDLETVSAFVEGAPPGELADVIADIKSLTLETSPDIISNLGPAFEKYNEEQFVTVKLPG
SSQPVIISSHNSLGDGRYYDVESSSSFAFDHTTQKASAVQSHVLEGAQADLVKSTLKSIG
PYVDEHFANAAHGVYPIESDSKIAIVIVGNKYSPNNFWNGRWRSLYVLDPSSGALEGSLK
VDVHYYEDGNVRLLTNKPVSSTISSVNGASIVREISTTERKYQEELNKGFVSLSEGAFKG
LRRQLPVTRQKIEWDRVTSYRLGQDIGGGSSRR
Download sequence
Identical sequences A0A2H3TXR9 F9FXE6 N4TZ88 W9PCS9 X0D709 X0HEA5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]