SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0A055 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0A055
Domain Number 1 Region: 15-67
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.0000000392
Family TTHA0281-like 0.07
Further Details:      
 
Domain Number 2 Region: 73-113
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000104
Family VCA0319-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0A055
Sequence length 159
Comment (tr|G0A055|G0A055_METMM) Uncharacterized protein {ECO:0000313|EMBL:AEG01194.1} KW=Complete proteome; Reference proteome OX=857087 OS=Methylomonas methanica (strain MC09). GN=Metme_2812 OC=Methylococcaceae; Methylomonas.
Sequence
MIDPSNYNITVRKGWFDGEHCYEARVAELPDVAEYADSFEEAYALAIDTIEVTAEMLAAQ
GKAIPSPMIPADEYSGRVTLRLAKSLHRSLAQAADMEGVSLNQHLTNILNYYAGYAQGLE
ARNSSENTSWQLASQTEKQYKHLRLISTSEPNALEKQYA
Download sequence
Identical sequences G0A055
gi|333984483|ref|YP_004513693.1| WP_013819428.1.77941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]