SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0ACN7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0ACN7
Domain Number 1 Region: 54-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.05e-77
Family Phosphate binding protein-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0ACN7
Sequence length 342
Comment (tr|G0ACN7|G0ACN7_COLFT) Substrate-binding region of ABC-type glycine betaine transport system {ECO:0000313|EMBL:AEK62911.1} KW=Complete proteome; Reference proteome OX=1005048 OS=Collimonas fungivorans (strain Ter331). GN=CFU_3086 OC=Oxalobacteraceae; Collimonas.
Sequence
MRRRACPFHSTCTGACIGLSSLFQEKKAMKSFSLMVAGVGVACSLLAPVQAQEPKSCQTV
RFADVGWTDIAATTGLASAVYEGLGYHTTKTIASVPITFAGVKNKQIDLFLGYWAPTMDP
IIAPFVKEKSLKVLATPNLTGAKYTLAVPTYAYDAGLKTFADIAKFSKELDGKIYGIEPG
NDGNALIQGMISKNQFNLKNFKMVESSEAGMLIELGRAIKQKKWIVILGWEPHPMNVQQK
ISYLSGGDDVFGPNYGEAKVYTVAATDYATRCPNADKLAGNLQFSTGIENQLMGRIMDKS
DPKTAAKEWLKKNPDVLEKLLAGVKTFDGKDGLPAVKASLGI
Download sequence
Identical sequences G0ACN7
gi|340788269|ref|YP_004753734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]