SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0AIH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0AIH6
Domain Number 1 Region: 164-350
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 3.4e-74
Family Methylesterase CheB, C-terminal domain 0.000000137
Further Details:      
 
Domain Number 2 Region: 5-110
Classification Level Classification E-value
Superfamily CheY-like 1.07e-27
Family CheY-related 0.00000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0AIH6
Sequence length 360
Comment (tr|G0AIH6|G0AIH6_COLFT) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=1005048 OS=Collimonas fungivorans (strain Ter331). GN=CFU_0927 OC=Oxalobacteraceae; Collimonas.
Sequence
MSDKKIKVLCVDDSALIRSLMTEIINSQADMTVVATAPDPLVARDLIKQLNPDVLTLDVE
MPRMDGLDFLEKLMRLRPMPVLMVSSLTERGSEITLRALELGAVDFVTKPRLGIREGLLE
YTDLIADKIRAAARARLQSVRRSDADAAAAAGLTPMLRSPLLSTEKLIIIGASTGGTEAI
REVLQPLPPDCPGIMIAQHMPPGFTRSFAQRLDGLCRITVKEAEHGERVLPGHAYIAPGG
FHLSLARSGANYVAHLDQEDPVNRHRPSIDVLFDSVAQHAGKNAIGVILTGMGRDGAAGL
LRMRQAGAYTLAQDEASCVVFGMPREAIAMGAASEVAGIAEMSTRLMARLMSYGERSNRV
Download sequence
Identical sequences G0AIH6
gi|340786117|ref|YP_004751582.1| WP_014004914.1.9183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]