SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0ALL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0ALL5
Domain Number 1 Region: 187-371
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.01e-61
Family Methylesterase CheB, C-terminal domain 0.00000579
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily CheY-like 0.00000000794
Family CheY-related 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0ALL5
Sequence length 375
Comment (tr|G0ALL5|G0ALL5_BORBD) Protein-glutamate methylesterase {ECO:0000256|SAAS:SAAS00706697} KW=Complete proteome OX=521010 OS=Borreliella bissettii (strain DN127) (Borrelia bissettii). GN=BbiDN127_0411 OC=Bacteria; Spirochaetes; Spirochaetales; Borreliaceae; Borreliella.
Sequence
METKISVLVIEYFAVKRKLISDLINSSPKLQVIATASNGKFATNKLKKHNPEVILMNLEE
NNIKDILFLEKKNNITKTIPIVVTSSNQNLINIAALKGADALILVSKNKKSHEIKKEQII
NLLLAYGSISIKNKIVCNKDVNTKNYERANFFLNHKNDISSLTQLEEHAKEKILNEKEIK
KLKLRKFDIIAIGVSAGGPAALKSILPEIPESFPPIIIVQHMPKGFTKEFAKNLNNLCKI
NVKEATNNEILKQGHAYISSGGYHTKIKKIYGNYQIQTLDGKHINGHKPSIGVLFQSIAE
IAKDKAIALIMTGMGNDGSREIGDIKKAGGLTIAQDQESSMVFGMPKIAIKENNIDYIVP
LNHMVKLLKAILINS
Download sequence
Identical sequences G0ALL5
WP_014023649.1.90944 gi|343127725|ref|YP_004777656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]