SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0EFF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0EFF4
Domain Number 1 Region: 3-104
Classification Level Classification E-value
Superfamily GlnB-like 8.9e-35
Family Prokaryotic signal transducing protein 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0EFF4
Sequence length 119
Comment (tr|G0EFF4|G0EFF4_PYRF1) Nitrogen regulatory protein P-II {ECO:0000313|EMBL:AEM38978.1} KW=Complete proteome; Reference proteome OX=694429 OS=Pyrolobus fumarii (strain DSM 11204 / 1A). GN=Pyrfu_1111 OC=Pyrodictiaceae; Pyrolobus.
Sequence
MTKLIIAFIRPEKLEDVKKELEAIGVYPMTIVEVRGRGEQRGITLMYRGHPVRVDLIPKL
QLEIIVEDDMVDKVIEAIVRGAYTGRPGDGRIIVLPVEKNIRIREEYEKLRTREQPPTP
Download sequence
Identical sequences G0EFF4
WP_014026655.1.63292 gi|347523660|ref|YP_004781230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]