SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0EFK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  G0EFK2
Domain Number - Region: 116-183
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000303
Family Tetracyclin repressor-like, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0EFK2
Sequence length 283
Comment (tr|G0EFK2|G0EFK2_PYRF1) Uncharacterized protein {ECO:0000313|EMBL:AEM39026.1} KW=Complete proteome; Reference proteome OX=694429 OS=Pyrolobus fumarii (strain DSM 11204 / 1A). GN=Pyrfu_1161 OC=Pyrodictiaceae; Pyrolobus.
Sequence
MRLYISRLREYIEERGNDTRFSFVLVELPFVVGAALSAVMLGLLLFALVLGAVTSIGTGT
EFVYMHSSRLQAASEVRIEATAGFAALLGLLVFWLVAAAVGFALWSVYAVYKLVAREVDH
RRRVDRIYQTVYELFTELGVDRARLAALRDRVDDARDALSEHSPGLWAIVYLVFSIVILY
ILHFLSRDLSRHERVERRLYEQIYEVLREKGVAAARPPILEGEATPERPTILYIVATLLT
LGVFLAYWVHVVNRDWNRHVAAHERTEKWLLETLEALAETTRS
Download sequence
Identical sequences G0EFK2
gi|347523708|ref|YP_004781278.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]