SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GCU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GCU4
Domain Number 1 Region: 144-216
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.000000000000144
Family Sporulation related repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0GCU4
Sequence length 224
Comment (tr|G0GCU4|G0GCU4_SPITZ) Sporulation domain-containing protein {ECO:0000313|EMBL:AEJ60513.1} KW=Complete proteome; Reference proteome OX=869211 OS=Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203). GN=Spith_0227 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
Sequence
MDRERILVVLVGVSVFLLVVVLVGMWWLTPREEKPVQVVTAGEQPRQSGFDAVEWVREGE
GFPGLLEGEEPLEGEFIVTETLFGSESPTPSPAPVAVQAAPSPTPVRPVSRGDRAPAPSP
TRTPTPRVETRAVEHTPTPVVREEFWIQIASFTSQARAAHVVEDLGEKGITARIVTKTMD
GVTYYRVRLGPYEKKAEAEKFLASIRNLEGYEKSYISLVYRRDP
Download sequence
Identical sequences G0GCU4
WP_014623914.1.62259 gi|386345981|ref|YP_006044230.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]