SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GCV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GCV8
Domain Number 1 Region: 31-83,861-916
Classification Level Classification E-value
Superfamily TPR-like 0.0000038
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Weak hits

Sequence:  G0GCV8
Domain Number - Region: 129-168,199-241
Classification Level Classification E-value
Superfamily TPR-like 0.00197
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0GCV8
Sequence length 977
Comment (tr|G0GCV8|G0GCV8_SPITZ) Uncharacterized protein {ECO:0000313|EMBL:AEJ61250.1} KW=Complete proteome; Reference proteome OX=869211 OS=Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203). GN=Spith_0977 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
Sequence
MGVRLLLWCLLVFLVGGVVYAGGQGEDELEMARRLIEEKRYNRAIEIITQVMREDPDRME
EAEALLARVRMVRGDFNALYAELIEVLYVQRDVERALEIIEELEGMDEEPDPAVRESLAR
AKETARFVYNQDRFRGIMEEGARLLDAGRYAEAVRLYQEGFGLYREEFFSSQYGNVILDE
VGRVVSRLEGVAGGLSEVLADFEDAWKGYAAVVEGGGVDEVVEGYAALREAAFRLAAARR
EVFRLGRVVAWENLRVMESAGLEREDFFLGFMQRFVLGRVQVREREGVVGALERALLEGL
GGVSAGLERRLEGVVQEGFGGAEVWEDAMRLAGVMVRLQECWGASGVWERGGMGDWEREI
VGRGGRTVLVGRAYGAVAGAMGRLREVLGVGVLEGDVDVRLAAVRERVAGVWGVMGELEE
MAGVFEGRFGAFGGRDAARVVEGAVRYLEGVAGEEERRAVRVVVEALAGDVGRMEEGVRE
VAAMVQGVRELLEGREEEVEVGGTLQTVLAKYPREALALAEEAEQALQGYLSFHASRSRV
YAAMEEYLRTDEGVERLVAGFDSSAEEARALLETLQGLKGQAREQSLLAERYRNEGLKKL
RDAERAIDREAYEEARTLLSEAGELFATSFSYQEDMELRREVDARLIALSERIVSEENQR
IIREVRSLITQGREQYLLGNFEEAERLLLRAQARWRVTHTEDNEEVVYWLKFVRAALAIQ
RGRTISETDPLYSEITQLLNLARQDYQRASTLIEGGRRDEGMGLLDQAVEKLLRVRMAFP
LNRDASILLLRIEQLRNPDNFDALFRRRIDESIAKLNTAPQEAYVELQDLAAIRPDFPGL
KDAIYRAEITLGVRVPPPDPRNIARAKELYVQALDIFNRNDRANFPVALEQLNQAITLDP
DNQDAVALKDRIQLAMGAQTTVTLPSYALRRYKEAEQKYVEGRYYEALAIVQELLADERA
KRYPPLLELKRRIESRL
Download sequence
Identical sequences G0GCV8
gi|386346718|ref|YP_006044967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]