SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GD03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GD03
Domain Number 1 Region: 51-178
Classification Level Classification E-value
Superfamily TPR-like 0.000000103
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 2 Region: 229-306
Classification Level Classification E-value
Superfamily Sporulation related repeat 0.000000124
Family Sporulation related repeat 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0GD03
Sequence length 307
Comment (tr|G0GD03|G0GD03_SPITZ) Sporulation domain-containing protein {ECO:0000313|EMBL:AEJ61295.1} KW=Complete proteome; Reference proteome OX=869211 OS=Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203). GN=Spith_1023 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
Sequence
MIPGRRHPARFRRRGRLYTLVLGLLLWCVPPGGLLPAEGVGAVSREQILALELSGDLEGA
LAALTRRYSVSRDPVDLFGIARLTYELGDFVLAESRTRELLSQDVSTVIKRDALLLLAHI
YLATGRFEDAHALTTALLDLSDPTPALLYTAFLASLLNGEGTSAERIRDRLEELFPESPE
SVLVRGLSASHAEISWYPSYMLSLGEGVTMSPAGSTGEQATTDEEGGLRVGIQVGSFLER
KNAQEMVDILGEKGFTALIVEAVRDGRTFFRVLLPVEAQTPSLTQERAQEILVSLKDQRI
EGFVVFY
Download sequence
Identical sequences G0GD03
WP_014624651.1.62259 gi|386346763|ref|YP_006045012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]