SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GE52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GE52
Domain Number 1 Region: 7-113
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000146
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0GE52
Sequence length 364
Comment (tr|G0GE52|G0GE52_SPITZ) Uncharacterized protein {ECO:0000313|EMBL:AEJ61405.1} KW=Complete proteome; Reference proteome OX=869211 OS=Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203). GN=Spith_1133 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
Sequence
MKESDLRMAQKLFSRRRYGDVIRLLEPLIFEYRESFTFYALLGLSCLHVGDYGGAETFLL
RAHHLRPERPEIIHGLALIYLKRGDSSSAIQRWLEILEDHPHYAPARHALDMVRTCRTDD
DLEDLITSPRFRKLFPRMRFHRRRLAPVLLLTSFAGILLIGGLIVFTIQGREREDALSPE
TRQILREIEAYNGALFSQEGEFRYVLTSREAQELLHEIQEALVAFDDNRARISINKILLS
NVAPEVKKKVEGLIPHLHPPEFGTLKTRVGFAEVMKDPPLYAGVGIQWKGRISNLEVGPD
AITFDFLVGYHTRRILEGIVPVEVPFPVTIDPERAYEIVGEIMIDERSPIGFLVRCHSLR
WLED
Download sequence
Identical sequences G0GE52
gi|386346873|ref|YP_006045122.1| WP_014624750.1.62259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]