SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GE88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GE88
Domain Number 1 Region: 14-171
Classification Level Classification E-value
Superfamily TPR-like 2.75e-32
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0GE88
Sequence length 194
Comment (tr|G0GE88|G0GE88_SPITZ) Tetratricopeptide TPR_2 repeat-containing protein {ECO:0000313|EMBL:AEJ61441.1} KW=Complete proteome; Reference proteome OX=869211 OS=Spirochaeta thermophila (strain ATCC 700085 / DSM 6578 / Z-1203). GN=Spith_R0023 OC=Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Spirochaeta.
Sequence
MSSHQEWDFSEIDALLQQGRYEEAIPLLQNILYEEPDHAGALHRLGVAFTESGRQGEAIK
TLSFALKKEEKDPDIWEAYGCACYRRGKLEEAKEAFEKAVELFPYHASALRNLGVTLHVM
KDFKASYRCLEKSREINPEDYLTLFALSNVCIHLKDFDQAREVLYQLLQLDIPEEIRKQA
EITLLNVELYSKHP
Download sequence
Identical sequences G0GE88
WP_014624786.1.62259 gi|386346909|ref|YP_006045158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]