SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GZY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GZY1
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily GlnB-like 6.04e-34
Family Prokaryotic signal transducing protein 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0GZY1
Sequence length 105
Comment (tr|G0GZY1|G0GZY1_METMI) Nitrogen regulatory protein P-II {ECO:0000313|EMBL:AEK19862.1} KW=Complete proteome OX=1053692 OS=Methanococcus maripaludis X1. GN=GYY_04965 OC=Methanococcaceae; Methanococcus.
Sequence
MKMIRAVVRPSKAEEVVDALAESGCVALTKMDVIGRGKQKGIKIDQIYYDELPKTMLMLV
VEDDAAENVIELITKTAYTGSFGDGKIFVSPVDEAYTVRTRSCGL
Download sequence
Identical sequences G0GZY1 P0CW45
267377.MMP0854 WP_011170798.1.40991 WP_011170798.1.41672 gi|340624152|ref|YP_004742605.1| gi|45358417|ref|NP_987974.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]