SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0GZY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0GZY2
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily GlnB-like 2.64e-31
Family Prokaryotic signal transducing protein 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0GZY2
Sequence length 121
Comment (tr|G0GZY2|G0GZY2_METMI) Nitrogen regulatory protein P-II {ECO:0000313|EMBL:AEK19863.1} KW=Complete proteome OX=1053692 OS=Methanococcus maripaludis X1. GN=GYY_04970 OC=Methanococcaceae; Methanococcus.
Sequence
MKEIIAIIRPSKMAQTKTVLEGLGFPAMTANRVLGRGKQKAIVGELGFEVDNKELLNQPG
DMRYIPKTMLTLIVPDEDASLVVEAIMKVNKSGQYGDGKIFVCPIEDIITVRTSERGEAA
I
Download sequence
Identical sequences G0GZY2 P0CW46 P0CW47
gi|45358418|ref|NP_987975.1| WP_011170799.1.40991 WP_011170799.1.41672 267377.MMP0855 gi|340624153|ref|YP_004742606.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]