SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0H0I6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0H0I6
Domain Number 1 Region: 74-135
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000000000126
Family NfeD domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0H0I6
Sequence length 137
Comment (tr|G0H0I6|G0H0I6_METMI) Uncharacterized protein {ECO:0000313|EMBL:AEK20067.1} KW=Complete proteome OX=1053692 OS=Methanococcus maripaludis X1. GN=GYY_06010 OC=Methanococcaceae; Methanococcus.
Sequence
MDLGYITIIIGMGLILLEAFLPGLNFPVAGVAVLIYGIFLLYAPQFALPSAILAGLITAY
IMKRFVYKTGLNVKIGAENLIGEHGDLVDEIDENNYGHVIIHGEKWQAKSENPIKKGSKV
IVVGIEGVSLIIEELNE
Download sequence
Identical sequences G0H0I6 Q6LYF6
gi|45358598|ref|NP_988155.1| WP_011170979.1.40991 WP_011170979.1.41672 gi|340624357|ref|YP_004742810.1| GO.2737 267377.MMP1035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]