SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0H4K4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0H4K4
Domain Number 1 Region: 9-242
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-75
Family SAICAR synthase 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0H4K4
Sequence length 246
Comment (tr|G0H4K4|G0H4K4_METMI) SAICAR synthetase {ECO:0000256|HAMAP-Rule:MF_00137} KW=Complete proteome OX=1053692 OS=Methanococcus maripaludis X1. GN=GYY_03780 OC=Methanococcaceae; Methanococcus.
Sequence
MSEYDISKILANEPIYAGKAKSIYKIEENEKEVLVEFRDDITAGNGAKHDVKSGKGYLNT
LISTELFNVLEKNNVPTHLIEYIEPNIMIAKNVKIIPLEVIVRNIAAGSLCKKYPFEQGQ
VLKTAVTQYDYKNDDYGDPMLNNEIAIELGLATEEELVEIKKLALKVNDVLKGFFDEKGI
MLVDFKIEVGKTVDGQIVVADEISPDTMRLWDKETKDVLDKDVFRKDLGDVLEKYKIVAE
RIGCLK
Download sequence
Identical sequences G0H4K4
gi|340623925|ref|YP_004742378.1| WP_013999102.1.41672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]