SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0HX30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0HX30
Domain Number 1 Region: 5-251
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.69e-46
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00065
Further Details:      
 
Domain Number 2 Region: 259-450
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 2.09e-39
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0HX30
Sequence length 452
Comment (tr|G0HX30|G0HX30_HALHT) 2',3'-cyclic-nucleotide 2'-phosphodiesterase / 5'-nucleotidase {ECO:0000313|EMBL:AEM56642.1} KW=Complete proteome OX=634497 OS=102182 / NCIMB 2187 / VKM B-1755). GN=HAH_1024 OC=Haloarcula.
Sequence
MSPRIIQYSDVEKAYDTPERIGRFAGTVAAADGPDALVVGTGDNTGPGVLSLVTDGEQSL
DLFTALTPAFETLGNHDFDHGLDATRDIIARSPQTWLTANVEQDGERFARRLTRPWASRT
VDGKQLGFVGVTDPDTAAANPQATTLTFTDPLEAVAEAATALRADGADVIVVLSHLGRTD
EELARTCDVDVILGGHVHERRIDRVAGTLLTRPGANGKTVVEVDLGGPEPTAQFRETADG
PVDDRVAEAIEDRLSAAGLDEVVGHVEEPLDRSRATTYGGECRLGNLVADAYRWATGADV
GLQNSGGLRNDTVPLDGALTVGDMVSVVPFEEPLTVAELTGSELRTLCRQGSGRQVEFGE
PDWWHAHLSGVELIWNDDTQTIERLRVDGRPVREAETYTLATSNYLYYTEREFPVLTESH
RVSVADVQYEALADYVRQTDIAPTVDGRLTRR
Download sequence
Identical sequences G0HX30 V5TLM8
gi|564289303|ref|YP_008875540.1| gi|344211310|ref|YP_004795630.1| WP_014039930.1.67629 WP_014039930.1.92404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]