SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0IVG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0IVG1
Domain Number 1 Region: 16-373
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.71e-90
Family GABA-aminotransferase-like 0.0000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0IVG1
Sequence length 376
Comment (tr|G0IVG1|G0IVG1_CYCMS) DegT/DnrJ/EryC1/StrS aminotransferase {ECO:0000313|EMBL:AEL24157.1} KW=Complete proteome; Reference proteome OX=880070 OS=marinus). GN=Cycma_0378 OC=Cyclobacterium.
Sequence
MKENSPIKFLDLKAINQAFEPELSETILQISRSGQYVNGEISAKFEKNFADYIGTQHCIS
LGNGTNALELILRAYLILGHLKEGDEVLVPANTFFATFLAISNQRLIPVAVEPELTSFNI
SARSLEQKITKKSRALVLVHLFGRNAYSEEIKQLIDKHQLKLIEDNAQAVGCMFKGVRTG
ALGHVSAHSFYPAKNLGALGDAGAVTTNEQELANIIRALTNYGGTEKHKYEYIGTHSKMD
EIQAGVLNVKLPHLDKNNCRRDEIASIYLDRIDSCHVTLPLKSKPSPLLSHTWHLFTLLV
SNRERLIQYLSQKGIETAIHYPIPPHLQPAYRKMNFGKLPLTERIHREILSIPLHPSLRE
NEVSTIIESINKWEGK
Download sequence
Identical sequences G0IVG1
WP_014018456.1.78327 gi|343083093|ref|YP_004772388.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]