SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0L080 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0L080
Domain Number 1 Region: 3-196
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.06e-39
Family Thiopurine S-methyltransferase 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0L080
Sequence length 197
Comment (tr|G0L080|G0L080_ZOBGA) SAM-dependent methyltransferase {ECO:0000313|EMBL:CAZ94179.1} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_106 OC=Flavobacteriaceae; Zobellia.
Sequence
MNDQHDYWTQRYKENNTGWDIGYPSTPIKTYVDQLTDKNLSILIPGAGNAYEAEYLWKEG
FKNVFVMDVSEIPLEHFLNRNPDFPKAQLLQENFFEHQGQYDLILEQTFFCSFPPTDDNR
NAYARQMAKLLKPKGKLVGLWFDIPLTGDMEKRPFGGSKELYLNHLNPFFKTTTFTRCYN
SIGPRADNELFGIFVKK
Download sequence
Identical sequences G0L080
gi|340616118|ref|YP_004734571.1| WP_013991492.1.92583 WP_013991492.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]