SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0L1S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0L1S1
Domain Number 1 Region: 44-183
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000000078
Family YhhF-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0L1S1
Sequence length 370
Comment (tr|G0L1S1|G0L1S1_ZOBGA) Uncharacterized protein {ECO:0000313|EMBL:CAZ97867.1} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_3729 OC=Flavobacteriaceae; Zobellia.
Sequence
MSVLLKKPYFGLVSNKELAEQLESRKKSEKKLNTWFNASNIYYPNKLNIEQTSSEITARY
KSEIVSGKSLVDLTGGFGVDSYFFSKKIDRVFHCEIDKNLSEIASHNFEVLGANNIETKA
ESGLDFIRNSERHFEWIYIDPSRRNDIKQRVFLLSDCQPDVIANLDLLFSKTEHILIKTA
PLLDISAGINELKHIKEIHIVALNNEVKELLWVLERGFKGEVTVKTVNKTKLDDQSFSFG
LEQERKCDSSFSLPLSYLYEPNAAILKSGAFKTIGHSYQLKKLQEHTHLYTSDELIDFPG
RRFKIEKVLPYNKKEIKRNAIRKANITTRNFPDSVADIRKKFSIKDGGELYIFFATNLER
KATVIIGSKV
Download sequence
Identical sequences G0L1S1
gi|340619693|ref|YP_004738146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]