SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0L8U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0L8U2
Domain Number 1 Region: 119-403
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.19e-67
Family NOL1/NOP2/sun 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0L8U2
Sequence length 403
Comment (tr|G0L8U2|G0L8U2_ZOBGA) Ribosomal RNA small subunit methyltransferase B {ECO:0000313|EMBL:CAZ94164.1} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_91 OC=Flavobacteriaceae; Zobellia.
Sequence
MKLHRNLVFAVIDALNLIFNEGEYADKVVQKVLKFDKRWGARDRGFIAETTYEMVRYKRL
YTEIAEVKAPFSRPDLFRMWAVWAVLKGIKLPDWKQLEPTPERRIKGRFDELSKIRKYRE
SLPDWIDEICLKALGEKLWNEESAALNQQAEVILRTNTLKTKKETLRKALLDEGIVAEPI
KGYADALRLPERANVFVTESFKKGYFEVQDASSQLVAAYLDVKPGQRVVDTCAGAGGKSL
HLAALMENKGQLIAMDIYGSKLKELKRRARRNNAHNIETREIDSTKVYKKLYGSADRVLI
DAPCTGLGVLRRNPDSKWKMQPEFLEKITKTQHEIIRNYSKIVKPGGKMVYATCSILPQE
NNDQVQSFLASEEGKDFSLVKEKKIYASKSGFDGFYMALLEKK
Download sequence
Identical sequences G0L8U2
WP_013991477.1.92583 WP_013991477.1.951 gi|340616103|ref|YP_004734556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]