SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0L9T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0L9T8
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.84e-32
Family Glucose-inhibited division protein B (GidB) 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) G0L9T8
Sequence length 211
Comment (tr|G0L9T8|G0L9T8_ZOBGA) 16S rRNA 7-methylguanosine methyltransferase {ECO:0000256|HAMAP-Rule:MF_00074} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_754 OC=Flavobacteriaceae; Zobellia.
Sequence
MTAELVFKYFPNLSELQQKRFILLEELYKDWNQKINVVSRKDIDELYLRHVLHSTGIAKV
QQFNDGASVLDVGTGGGFPGVPLAILFPEVQFTLVDSIGKKIKVVEEVVQGLGIDNVRTI
NARVEETKEQHDFIVSRAVAAMPTFVHWVKGRIKKDSLHERRNGILYLKGGDLSEELEGY
KSVETYDLTDYFEESFFETKKVVYLPMKYKG
Download sequence
Identical sequences G0L9T8
WP_013992132.1.92583 WP_013992132.1.951 gi|340616758|ref|YP_004735211.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]