SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LAL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LAL6
Domain Number 1 Region: 9-116,145-416
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.93e-111
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 400-504
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.22e-32
Family Anticodon-binding domain of Class II aaRS 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0LAL6
Sequence length 516
Comment (tr|G0LAL6|G0LAL6_ZOBGA) Glycyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00253} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_1420 OC=Flavobacteriaceae; Zobellia.
Sequence
MAKQEDDFKKVISHAKEYGYVFQSSEIYDGLSAVYDYAQNGAELKKNIREYWWKAMVQLN
DNIVGIDAAIFMHPTTWKASGHVDAFNDPLIDNKDSKKRYRADVLVEDHVAKIEAKIEKE
VAKAAKRFGDKFDKEQFLATNQRVVDYQEQATAILKRLGRSLENEDLADVKKLIEELDIA
CPMSGSKNWTEVKQFNLMFGTKLGATADSAMDLYLRPETAQGIFVNFLNVQKTGRMKIPF
GIAQTGKAFRNEIVARQFIFRMREFEQMEMQYFIKPGTQQEWYEKWKENRMKWHLSLGLG
EDNYRFHDHEKLAHYADAAADIEFRFPFGFKELEGIHSRTDFDLSSHEKFSGKKLQYFDP
ETRESYVPYVLETSIGLDRMFLAVFSNSLVEEELENGSTRTVLKLPAVLAPTKAAILPLV
KKDGLPEVAHEIIEDLKWDFNVTYDEKDAVGRRYRRQDANGTPFCITVDHQTLEDRTVTI
RHRDSMEQERVSISSLKEIIHKAVDMKTWLMKMQKL
Download sequence
Identical sequences G0LAL6
WP_013992785.1.92583 WP_013992785.1.951 gi|340617411|ref|YP_004735864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]