SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for G0LCE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LCE7
Domain Number 1 Region: 50-274
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.92e-34
Family Ribosomal protein L11 methyltransferase PrmA 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) G0LCE7
Sequence length 278
Comment (tr|G0LCE7|G0LCE7_ZOBGA) Ribosomal protein L11 methyltransferase {ECO:0000313|EMBL:CAZ96929.1} KW=Complete proteome; Reference proteome OX=63186 OS=NCIMB 13871 / Dsij). GN=zobellia_2781 OC=Flavobacteriaceae; Zobellia.
Sequence
MSNTIYIEYNFSVSPLQPGSDILIAELGEAGFESFVENEEGVLAYIQKEDWNENILETVE
ILDNSIFEVGFSIKEIEQENWNATWEKNFEAIQVADQCVVRAPFHEKPDVAFDIVIEPKM
SFGTGHHETTYMMLQFVLENDFEGKDVLDMGSGTGVLAILAALKKAAHIDAIDIDNWCYL
NAKENVERNNCSHISVFEGDSSLLGERKYNVILANINRNILLADIPVYAQNLRENGALFL
SGFYEEDIPLISETCLKAGLKFEKNLQKNNWVAVKYVF
Download sequence
Identical sequences G0LCE7
WP_013994125.1.951 gi|340618755|ref|YP_004737208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]