SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for G0LF21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  G0LF21
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-31
Family GHMP Kinase, N-terminal domain 0.0000592
Further Details:      
 
Domain Number 2 Region: 155-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.58e-25
Family Homoserine kinase 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) G0LF21
Sequence length 291
Comment (tr|G0LF21|G0LF21_HALWC) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome OX=768065 OS=Haloquadratum walsbyi (strain DSM 16854 / JCM 12705 / C23). GN=Hqrw_3851 OC=Haloquadratum.
Sequence
METVRAPATSANLGSGFDVFGVALDRPADIVRVERADKTTIEVTGVGSQYIPEDPHSNVV
GAVAEALDAPAQIQIDKGVRPSSGLGSSAASAAAAAVALNGLYDRGLSRTELVPIAAEGE
AIVSGEAHVDNVAPALLGGFTIARNSTVTTVDTTIPLVACLPEIAVSTRDARRVVPDSIT
MEEAVHTVGSAATLTVGMCQSNPALVGAGMDEHVVTPARAELVTGYDTVREAALTAGATG
VTVSGAGPAILAVCKAERRRAVAAAMIDAFETADVEARAYQTCVSAGATLF
Download sequence
Identical sequences G0LF21 Q18F42
gi|385804769|ref|YP_005841169.1| WP_014556925.1.31310 WP_014556925.1.96088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]